Essentialism: The Disciplined Pursuit of Less Paperback - 2014
by Greg McKeown
Summary
Reader reviews for Essentialism: The Disciplined Pursuit of Less
Review summary
Readers largely welcomed Greg McKeown’s call to pursue “less but better,” praising its clear, practical rules for prioritization and its usefulness across work and personal life. Many reported tangible changes—saying no more often, canceling commitments, and guarding sleep and focus—and some highlighted the engaging audiobook narration. Critics found the ideas familiar and padded, calling it repetitive, wordy, and at times tone-deaf, arguing it could have been a much shorter piece. Overall, impact varied by reader: transformative for those feeling overextended, redundant for those already versed in similar self-help frameworks.
Readers say this book is:
motivatingpracticalactionableinspiringtimelylife-changingwork-life applicablerepetitivewordyderivativeWrite a review for this book
Important Terms and Guidelines
- Please focus on the book’s content and context. Also, add any personal comments as to how you enjoyed the book. Substantiate your likes and dislikes. You may make comparisons to other books.
- Reviews must be at least 140 characters in length.
- Please do not reveal critical plot elements.
- This is not a help line. Contact customer support if you need help.
Your review must not include:
- Obscenities, discriminatory language, or other insulting language not suitable for public domain
- Advertisements, “spam” content, or references to other products, offers or websites.
- Email addresses, URLs, phone numbers, physical addresses or other contact information.
- Overly critical comments about other reviews or reviewers
- Time-sensitive material (i.e. promotional tours, seminars, lectures, etc.)
- Availability, price, or alternative ordering/shipping information
Details
- Title Essentialism: The Disciplined Pursuit of Less
- Author Greg McKeown
- Binding Paperback
- Edition International Ed
- Pages 288
- Volumes 1
- Language ENG
- Publisher Virgin Books
- Publication date 2014-01
- ISBN 9780753555163 / 0753555166
- Weight 0.63 lbs (0.29 kg)
- Dimensions 8.51 x 5.32 x 0.6 in (21.62 x 13.51 x 1.52 cm)
- Category Business / Economics / Finance
- Dewey Decimal Code 153.83
More Copies for Sale
Essentialism: The Disciplined Pursuit of Less
by Greg McKeown
- Used
- Good
- Paperback
- Condition
- Good
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 1
- Seller
- Item price
-
A$2.44A$5.83 Delivery to USA
Show details
Essentialism: The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- as new
- Paperback
- Condition
- New
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 2
- Seller
- Item price
-
A$9.48Free Delivery to USA
Show details
Essentialism: The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Very good
- Paperback
- Condition
- Very good
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 2
- Seller
- Item price
-
A$9.48Free Delivery to USA
Show details
Essentialism: The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Acceptable
- Paperback
- Condition
- Acceptable
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 3
- Seller
- Item price
-
A$9.48Free Delivery to USA
Show details
Essentialism : The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Condition
- Used
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 2
- Seller
- Item price
-
A$12.30Free Delivery to USA
Show details
Essentialism : The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Condition
- Used
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 7
- Seller
- Item price
-
A$12.30Free Delivery to USA
Show details
Essentialism : The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Condition
- Used
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 2
- Seller
- Item price
-
A$12.30Free Delivery to USA
Show details
Essentialism : The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Condition
- Used
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 2
- Seller
- Item price
-
A$12.30Free Delivery to USA
Show details
Essentialism: The Disciplined Pursuit of Less
by McKeown, Greg
- Used
- Paperback
- Condition
- Used
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 1
- Seller
- Item price
-
A$13.19Free Delivery to USA
Show details
Essentialism: The Disciplined Pursuit of Less
by Greg McKeown
- Used
- Good
- Paperback
- Condition
- Good
- Binding
- Paperback
- ISBN 10 / ISBN 13
- 9780753555163 / 0753555166
- Quantity available
- 1
- Seller
- Item price
-
A$14.34Free Delivery to USA